Opened 16 years ago
Closed 16 years ago
#7381 closed (fixed)
1406, "Data too long for column" DataError in WindowsXP
| Reported by: | Owned by: | nobody | |
|---|---|---|---|
| Component: | Uncategorized | Version: | dev |
| Severity: | Keywords: | ||
| Cc: | Triage Stage: | Unreviewed | |
| Has patch: | no | Needs documentation: | no |
| Needs tests: | no | Patch needs improvement: | no |
| Easy pickings: | no | UI/UX: | no |
Description
I am getting a DataError at /admin/polls/poll/5/
(1406, "Data too long for column 'choice' at row 1"),
The data I'm trying to input is this below, as you can see it's not
very long. I'm working in windows. The
model field is set as a textfield which is taking longtext.
I am able to input the first three lines of this into
the database before I get this error message so I'm guessing it's not
any special characters nor the line breaks - this is the same with
other similar data. Also my MySQL database works fine inputing the
data as longtext without using Django.
input data:
">gi|3819788|emb|CAA09968.1| immunoglobulin heavy chain, constant region, alpha-2 subunit [Homo sapiens]
VPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDAS
GATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTF
RPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTS
ILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY"