id summary reporter owner description type status component version severity resolution keywords cc stage has_patch needs_docs needs_tests needs_better_patch easy ui_ux 7381 "1406, ""Data too long for column"" DataError in WindowsXP" Emily nobody "I am getting a !DataError at /admin/polls/poll/5/ (1406, ""Data too long for column 'choice' at row 1""), The data I'm trying to input is this below, as you can see it's not very long. I'm working in windows. The model field is set as a textfield which is taking longtext. I am able to input the first three lines of this into the database before I get this error message so I'm guessing it's not any special characters nor the line breaks - this is the same with other similar data. Also my MySQL database works fine inputing the data as longtext without using Django. ---------------------- input data: "">gi|3819788|emb|CAA09968.1| immunoglobulin heavy chain, constant region, alpha-2 subunit [Homo sapiens] VPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDAS GATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTF RPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTS ILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY"" " closed Uncategorized dev fixed Unreviewed 0 0 0 0 0 0